Placement Specialist

Login for job apply.

Futurense Technologies

  • Salary:
  • Location: Bengaluru
  • Key Skills: Accounting

Job Description:

Job description We are looking for a highly skilled and experienced Placement Specialist to join our team at FutureNse Technologies Private Limited. The ideal candidate should have experience in placement and hiring for client companies in the AI, ML, Data Science domain. Roles and Responsibility Develop and implement effective recruitment strategies to attract top talent. Build and maintain strong relationships with clients and candidates in the AI, ML, Data Science domain. Conduct thorough interviews and assessments to ensure the best fit for each role. Collaborate with internal teams to understand hiring needs and develop targeted recruitment plans. Manage job postings, resumes, and other recruitment materials efficiently. Analyze recruitment metrics to identify areas for improvement and optimize processes accordingly. Job Requirements Proven experience in placement and hiring for client companies in the AI, ML, Data Science domain. Strong understanding of the recruitment process and industry trends. Excellent communication, negotiation, and interpersonal skills. Ability to work independently and as part of a team. Strong analytical and problem-solving skills. Familiarity with recruitment software and tools is an advantage. About Company FutureNse Technologies Private Limited is a leading company in the AI, ML, Data Science domain, committed to delivering innovative solutions and services to its clients. We are a dynamic and fast-paced environment, offering opportunities for growth and development to our employees. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Placement / Alumni Officer Industry Type: Education / Training Department: Teaching & Training Employment Type: Full Time, Permanent Role Category: University Level Educator Education UG: Any Graduate PG: Any Postgraduate Key Skills staphysical designscreeningsoftwarehiringprimetimelvshrsdtiming analysisfloorplansourcingphysical verificationtalent acquisitionfloor planningtiming closuredrcrecruitmentpnrnegotiationplacementtclcommunication skills